SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284161420|ref|YP_003400043.1| from Archaeoglobus profundus DSM 5631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284161420|ref|YP_003400043.1|
Domain Number 1 Region: 361-432,514-650
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.32e-33
Family Terpene synthases 0.0057
Further Details:      
 
Domain Number 2 Region: 401-525
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000403
Family Terpene synthases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284161420|ref|YP_003400043.1|
Sequence length 759
Comment prenyltransferase/squalene oxidase [Archaeoglobus profundus DSM 5631]
Sequence
MKKVILVLFVILTVQTAQALTINVQGDFIVGHKLTISTDKPALIILRMNNGTPIYANTST
NFTPQVAGMLTIEAIAGCERASKVIEIRQPATSSMGSSGWIGRYYLPSGTTTITLEDGGS
ATINWRTALGVLIKASQERGFSVKIKKWSYGLFVDCIGGICTRALGETSGWVYQVNGETP
MVSSEQYNLNAGDTVVWYFSRSMSEAPESSPYRITIKTYDDWSFDVSINPAMPWSLPSEE
TGSSSVSTTPTPTPTIPSKMSVARTNNSITCTVVGNVTVEVNVTKIPLKVSVRSAKAVLL
KISKYEPKGLEFNEIYATPLDCFDLELNRSTNVTISFVIPKEKLTKLDAKPEDVCIAEYE
GKWKFIPTNYTENETYYTFTANLTSFSIFAIVAKWESFPLNSSDERIVKALNWLKSQQRP
DGGWGSLSNTSWVVMAIASANENPCDWIKNGKSPLDYFKANLNESVIERMGTSDFARTIL
ALIALNQNPYNFNGINFVEKLKERVKEDGQIGDYIYTTIWGILALKACGENVSKSVEWLK
AHQNPDGGFAWAVNAESDFDDTASAIQALIASGVSRDDPVIKKALNYLKKGQCEDGGMRY
FGNSSSNADSDAWTIQALVSACVNPTNWKTSKSVVEHLLSLQAEDGHFKYTKYVTSIPIK
VTADSVMALLGKPHPVKILLNRTTQVTANRTVAVTTEVTYVTYTTITPTPTTITKTVAST
TTIATTNPPKVTATTKKVYGFEAILGILALLFVMFYRRS
Download sequence
Identical sequences D2RGE5
gi|284161420|ref|YP_003400043.1| WP_012939706.1.89191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]