SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284162045|ref|YP_003400668.1| from Archaeoglobus profundus DSM 5631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284162045|ref|YP_003400668.1|
Domain Number 1 Region: 62-209
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000149
Family Quinoprotein alcohol dehydrogenase-like 0.022
Further Details:      
 
Domain Number 2 Region: 298-382
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000576
Family Transglutaminase, two C-terminal domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284162045|ref|YP_003400668.1|
Sequence length 417
Comment hypothetical protein Arcpr_0934 [Archaeoglobus profundus DSM 5631]
Sequence
MCQVEAMETQLEEAKEIKLIKPADRWVYCKRGEIVCYENILVGRNFVVSFDKPIFEISVD
KTIAVRTENEVALIGPEGNIIWRKKIKANAVSCRNDKVAVGVGKKVLVLNGSGEKVLSKR
VGKVLALDFDGEIFIVATDKGIKCLNSEGEELWKLHLKANLVRVGYAVAVSNYNDLILLT
RDGHVLWSKKLDGIVYDVKFGDDGITAYTYGSKVKFDFEGRIVEVVREEYDFKFLPLPHI
LVQRKIDEIKSLLKLSKDLKPKSVKRLVKQAKKYFKRREYGRSYEFILTAIEELERLQLV
VELPKKVYINEAFNVKIGYKNVLHDVVENLVVDLTDLEKYFEVEPKMIEFPPVRRGMVVR
SDVKIVPKYEGTFKVIVNARSSVGELSREFEITVARKRLFRLFRREKGEETLLELLE
Download sequence
Identical sequences D2RI70
gi|284162045|ref|YP_003400668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]