SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294673269|ref|YP_003573885.1| from Prevotella ruminicola 23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294673269|ref|YP_003573885.1|
Domain Number 1 Region: 30-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.01e-18
Family Glutathione peroxidase-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294673269|ref|YP_003573885.1|
Sequence length 178
Comment thiol-disulfide oxidoreductase [Prevotella ruminicola 23]
Sequence
MLAALLMTACGGCSATDDKVDGDEVMDADSLVVGDQLPAFEVTMNDGSVVRTADLKGQPS
VVVLFSVDCPDCRHELPEVQKLWDRSRQGELTGDGKPLPIVLIARKNLTEDIEPFWKFAE
LTMPYSPQPDRKVYSRFAPSRIPRIYISDASATIRVAYADTGMPTAETLAEEISRLNE
Download sequence
Identical sequences A0A1H6MM72 D5EXQ2
WP_013065363.1.33358 WP_013065363.1.49956 gi|294673269|ref|YP_003573885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]