SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294674709|ref|YP_003575325.1| from Prevotella ruminicola 23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294674709|ref|YP_003575325.1|
Domain Number 1 Region: 217-352
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.71e-20
Family Thioltransferase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294674709|ref|YP_003575325.1|
Sequence length 484
Comment hypothetical protein PRU_2053 [Prevotella ruminicola 23]
Sequence
MKKKTIITAMLALIAMMGLAQTQTATITGEVPAVKDGTVIGLATGSLGHDVGTVQNGRFS
LSVPVEDVTLVSLDFMGEGCPSRTFNVILRPGAHVKVSGTDCLYPLWKVESDVPEQQTQN
RLVDHCRDLLEKCMKLELAGAWKETEPIRLEITKRELDILPLLPIDAASIEKLYEISISA
KVTKDFPYLEQARALEKRFAAHAPQALKTQMDEIHANLYPPRLLQVGNQAVDYELFDLQG
NKHYLSDAFADGRYVLLDFWAIGCGPCRMAEAEMKDFYEKMKGKLEIVGISLDDLPQWKE
HEFSKRIAWKNWNDGFKGINIVSSYCDVHAKPYYVLLSPDKRIVWKAMGYVPGYFMGMYD
ALNGLPQDNTSNLALVVTKVEADANATKVSFRYYTLKEYPFAVARQSYIAANGKRYKVTA
ADGITLDERTFVKVKAHTATEGTLANIYYSDFTLTFEPFDTKPATFDFREGDGEDVFVIR
NISL
Download sequence
Identical sequences D5EUM1
gi|294674709|ref|YP_003575325.1| WP_013063669.1.33358 WP_013063669.1.49956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]