SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294675264|ref|YP_003575880.1| from Prevotella ruminicola 23

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294675264|ref|YP_003575880.1|
Domain Number 1 Region: 256-384
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000456
Family Glutathione peroxidase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294675264|ref|YP_003575880.1|
Sequence length 384
Comment lipoprotein [Prevotella ruminicola 23]
Sequence
MKHICKAAAVVLAALSIASCNNNKFTVEGQIAGAKDSVLYFENVGLEGINVLDSVKLNDN
GDFSFSQDATTAPEFYRLRIADQIINVSIDSTETVQVKGQYPGMASNYTISGSENCEKIR
ELALKQIDLQAKAIALQSNTELGIAKANDSIQSMINAYKEEVKRNYIYKEPYKAYAYFAL
FQAIGNYLIFNPRANKEDIKAFAAVATSWDTYYPHAERGQNLHNIAIEGMKNQRIVEAQN
ADIQIEASKVQEAGVLDIALLDNKGNMRHLTDLKGQVVLLDFHVFALKDSPARIIQLREL
YNKYHAQGLEIYQVSLDSDEHFWKQQTAALPWISVRDEDGAGSQRLTLYNIQAVPDFFVI
DRGNNLVKRAAQIADLEAEIKKLL
Download sequence
Identical sequences A0A1H6LJL0 D5EXD7
WP_013065265.1.33358 WP_013065265.1.49956 WP_013065265.1.69841 gi|294675264|ref|YP_003575880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]