SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|160900466|ref|YP_001566048.1| from Delftia acidovorans SPH-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|160900466|ref|YP_001566048.1|
Domain Number 1 Region: 35-247
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.88e-41
Family Phospholipase D 0.022
Further Details:      
 
Domain Number 2 Region: 276-395,426-493
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.44e-33
Family Phospholipase D 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|160900466|ref|YP_001566048.1|
Sequence length 543
Comment phospholipase D/transphosphatidylase [Delftia acidovorans SPH-1]
Sequence
MPLLRRALATTQALVLALLLAGCSLPPLAGRSESTALPPEAAQATLLGQALAPLLDQHPG
LTGIHALSDARNAYAARALLARVAQRTLDVQYYIWRDDTTGHLLLDELRQAADRGVRVRL
LLDDGGTAGLDTQLSALDRHPQIEVRLFNPFAQRTPKALGYVTDFSRTQRRMHNKSFTAD
SQASIVGGRNIGDEYFAATDGVLFADLDVVAMGPVVADIAHSFDQYWASASAYPVASLLP
PLPDYAVARASEALATEVQRPEAQAYVRAVAQSPFTQELLAGRLPLQWARTTLVSDDPAK
VLGQVPRQGLLITQLAPAIGQPQRQLDLVSPYFVPTEAGVRALAGLRRQGIAVRVLTNSL
EATDVAVVHAGYARYRRPLIEEGVQLYELRRQIGEPDTPAADAGVPRQAPPSPAASSGGK
AGVGSGSRPGSSGSSLHAKTFAVDGERIFVGSFNFDPRSAHLNTEMGLLIDSPEMASQMS
RMLDQSLPSAAYHVQIDAQGRLSWTTESGTPPEPLTTTTEPGSSAFKRLMLRVLGWLPIE
GLL
Download sequence
Identical sequences A9BMW8
WP_012206833.1.82428 gi|160900466|ref|YP_001566048.1| 398578.Daci_5034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]