SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157369651|ref|YP_001477640.1| from Serratia proteamaculans 568

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157369651|ref|YP_001477640.1|
Domain Number 1 Region: 158-294
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.14e-17
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 3-64
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000547
Family GntR-like transcriptional regulators 0.037
Further Details:      
 
Domain Number 3 Region: 94-151
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000156
Family Transcriptional regulator Rrf2 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|157369651|ref|YP_001477640.1|
Sequence length 301
Comment GntR family transcriptional regulator [Serratia proteamaculans 568]
Sequence
MSRTQNLRHNVVNQMIDGINNNHLRSPLPSQAALAEMYNISRTTVRHTLTHLFQRGVLEK
VGDDYVILRQPQPEDGFDCQSPSLDEQGKRFEKAFYQMINQKQLRAGDSFSELQLARAVN
VSPVVVREFLLHFSRYNLIESSKRGQWRMKQFDQRYAEQLFELRQMLETHALSHFINLPA
HDPRWLQARELLSRHRQLREDISDNYRLFSQLDRDFHLLILSAANNPFFNQSLEIISVIF
HFHYQWDETDLKQRNIIAIEEHMTILSALICRNDQEAINALHRHLDTAKQSMIRSLNQTI
A
Download sequence
Identical sequences A8GBM2
399741.Spro_1408 WP_012005841.1.35080 gi|157369651|ref|YP_001477640.1| Aqu1.206822|PACid:15705350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]