SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|172040327|ref|YP_001800041.1| from Corynebacterium urealyticum DSM 7109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172040327|ref|YP_001800041.1|
Domain Number 1 Region: 143-320
Classification Level Classification E-value
Superfamily MCP/YpsA-like 1.42e-57
Family MoCo carrier protein-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 12-124
Classification Level Classification E-value
Superfamily Nudix 1.49e-20
Family MutT-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|172040327|ref|YP_001800041.1|
Sequence length 329
Comment hypothetical protein cur_0647 [Corynebacterium urealyticum DSM 7109]
Sequence
MSITDPESVITVSATVIRDPHGRVLCVRKEGSPYFQLPGGKPEAGESSAQAATREAAEEI
GVELKEEDLSFLGIFSAQAANEKGFQVRSTVYTHPYTEALGQVAGGQAEIAETRWLDITT
PEELDEQLAPLLAQRIGPALGRRINSVTVFTGAKTGTGEEYVAQAREFGQPLADRGITLV
YGGGHVGLMGEIADGVLENGGHVVGVMPRHLVDEEIAHPGLSALLVVESMAERKQVMTDL
ADGFVALPGGVGTLDEVFEVWTGLQLGTHGKPVALCNSRFWQPLVTGLAAMVSEGFIRAA
DIDSLIVTEDAAETLERFEGWQPPRPRWS
Download sequence
Identical sequences B1VFR8
504474.cur_0647 WP_012359898.1.62580 gi|172040327|ref|YP_001800041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]