SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|172040539|ref|YP_001800253.1| from Corynebacterium urealyticum DSM 7109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|172040539|ref|YP_001800253.1|
Domain Number 1 Region: 35-177
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-45
Family Ribonuclease PH domain 1-like 0.000000812
Further Details:      
 
Domain Number 2 Region: 365-534
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-42
Family Ribonuclease PH domain 1-like 0.00000211
Further Details:      
 
Domain Number 3 Region: 516-615
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.11e-22
Family Ribonuclease PH domain 2-like 0.0000228
Further Details:      
 
Domain Number 4 Region: 294-391
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.31e-22
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0008
Further Details:      
 
Domain Number 5 Region: 180-302
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.82e-20
Family Ribonuclease PH domain 2-like 0.0000579
Further Details:      
 
Domain Number 6 Region: 624-710
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.9e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 7 Region: 688-759
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000158
Family Cold shock DNA-binding domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|172040539|ref|YP_001800253.1|
Sequence length 765
Comment polynucleotide phosphorylase [Corynebacterium urealyticum DSM 7109]
Sequence
MKGRGTHAMSSKKNNLPKNVSVEMVDPDAGIWEATATIDNGDFGSRTLRFETGLLARQAD
GAVTAYLDEDTILLSTTTASRSPREGIDFFPLTVDVEERMYSAGRIPGSFFRREGRPGTD
AILAARLIDRPLRPTFVKGLRNEVQVVITVMSIDPNEMYDVLAINGASASTQLSGLPVSS
SVGGVRMALVVDEEHPEGQWVAFPTREQVSQSVFELVVAGRVTEPAKGGRGKKSQPNVAV
MMVEAGATDNVVERIAEGAPAPTEAVVAEGIEAAKPFIATLCAAQDALRDAVDTESREFE
LFPPFDEDVYSAVEAECDADVAQIMTIADKQERDESLAENMQETVDALIEQFPERESEIR
AAHNDLTRTIVRQRILEDGFRIDGRDHTSIRDLGIVVQLLPRAHGSALFERGETQILGVT
TLDTLKMEQTIDSLGPETSKRYIHHYNFPPYSTGETGRVGSPKRREIGHGALAERALTPV
LPSREEFPYTIRQVSEALGSNGSTSMGSVCASTLSLYNAGVPLKAPVAGIAMGLVSGLVD
GKEKFVSLTDILGAEDAFGDMDFKVAGTSEYVTALQLDTKLDGLPSEVLASALGQARSAR
LEILQLMEDAIDAPDQMSELAPRITKISIPQNKIGEVIGPKGKTINQITEETGANISIED
DGTVFVSAVGGEAAEAAIEKINAIANPQQPKVGDRFLGTVVKTTAFGAFISLLPGRDGLL
HISNIGGDRRIEKVEDELNVGDKIQVEIADIDNRGKISLVPVDED
Download sequence
Identical sequences B1VDC1
WP_012360108.1.62580 504474.cur_0859 gi|172040539|ref|YP_001800253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]