SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171058126|ref|YP_001790475.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171058126|ref|YP_001790475.1|
Domain Number 1 Region: 147-573
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.49e-118
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000000000079
Further Details:      
 
Domain Number 2 Region: 8-159
Classification Level Classification E-value
Superfamily Cytochrome c 2.33e-17
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171058126|ref|YP_001790475.1|
Sequence length 573
Comment hydroxylamine reductase [Leptothrix cholodnii SP-6]
Sequence
MTTSKITRLTALALAALAMTAIQAQDKKGITQPEMNYQAGGSPLAGEAMYQGTNPKAPPM
TQAEFDLGRKTYFERCAGCHGVLRKGATGKPLTPDLTVAKGTDYLKVFIAYGSAAGMPNW
MTSGEMDEKTVDVMARYIQHDAPTPPEWSMAQTKATWKVIIAPEKRPTKKMNNYNIANIF
STTLRDTGEVALIDGDTKKIINIVKTGYAVHITRTSASGRYLYVIGRDAKINMIDLWMAT
PDNVAEVRVGLEARSVDTSKFKGYEDKLAIAGSYWPPQFTIMNGDTLEPLKIVSTRGMVV
GTQEYHPEPRVASIVASHFKPEFVVNVKETGKTLMVDYSNLDALKITEIGSAPFLHDGGW
DSSKRYFMVAANQSNKIAAIDAKDGKLAAITEVGKIPHPGRGANFTHPKFGPVWSTGHLG
DETISLIGTDPKGHKQYAFKEVMKLKGPGGGALFIKSHPKSRHLYSDTPLNPDPKLSQSV
AVYDVNNLDKGYVTLPIAEWAGLSDDGAKRVVQPEFNKAGDEVWFAVWSAKNKQSALVIV
DDKTLKLKAVIKDPRLITPTGHFNVHNTQHDVY
Download sequence
Identical sequences B1Y7W8
gi|171058126|ref|YP_001790475.1| WP_012346472.1.27902 395495.Lcho_1442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]