SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171059499|ref|YP_001791848.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059499|ref|YP_001791848.1|
Domain Number 1 Region: 31-222
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.75e-35
Family RNA methyltransferase FtsJ 0.0000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|171059499|ref|YP_001791848.1|
Sequence length 232
Comment ribosomal RNA methyltransferase RrmJ/FtsJ [Leptothrix cholodnii SP-6]
Sequence
MKINTKSKKVNKAWFNDHIHDTYVKLAHKEGYRSRAAYKIKEIDETCGLIRPGQVVVDLG
AVPGAWSQYVRRRFAPREAGVGGAAAGELNGRIIALDLLPFEPLEGVAFLQGDFCEEAVL
AQLVGLLDGRAVDVVLSDMAPNLSGVEVTDAARIANLVELALEFAQSHLKPQGALVCKVF
HGSGYSQLVDQFKRTFRVVKAVKPKASRDRSAETFLVGIGLKSTGMPNADAV
Download sequence
Identical sequences B1XXG3
gi|171059499|ref|YP_001791848.1| 395495.Lcho_2818 WP_012347837.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]