SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171059789|ref|YP_001792138.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059789|ref|YP_001792138.1|
Domain Number 1 Region: 8-292
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.39e-62
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171059789|ref|YP_001792138.1|
Sequence length 310
Comment hypothetical protein Lcho_3113 [Leptothrix cholodnii SP-6]
Sequence
MSQPAAAAPFAYVTNQGSHDVSVIDLADPRTIARVPVGQSPAGVVAASARGEVFVANAAG
NSISVIDMRSQQVVDTFAAGQGAVGLDASADGRRLFVVDWYGAALRVFDASTRRQIAHVP
LGPAPAGVAALPDGSAAWVAERDDDRVALIDVARAQVVARVAVGSHPFALLLDSARERLY
ALNVQSDSVSVIDTRSRQVIATLPTGRAPYGAVLADGARLLYVTNQHDDSVSVFDAQSLK
PLRTLGGFGYPEGIAASGERVYVVNWMDDQLSVLDAASGRLLATLATGRNPRGFGAFIGT
PPPHPRSPDE
Download sequence
Identical sequences B1Y092
gi|171059789|ref|YP_001792138.1| 395495.Lcho_3113 WP_012348124.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]