SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171059889|ref|YP_001792238.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171059889|ref|YP_001792238.1|
Domain Number 1 Region: 63-198,243-356
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.7e-17
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171059889|ref|YP_001792238.1|
Sequence length 576
Comment hypothetical protein Lcho_3215 [Leptothrix cholodnii SP-6]
Sequence
MRIPAFPLARTVLASALLSAGLLGTACGGGDPVAVPEATPTSLSLARIGGYADASLTNPV
GAAEITAFDAASKRLFVVNSVLATVDVLDLANPAAPVKLASIDISALGASVNSVAVSNGL
VALAIEANPKTAPGVVAFYNASNLALLGQVTVGALPDMLTFTPDGQTVVVANEGEPANYA
VAATATTPAIAADDPEGSISVISVTRTGSASTLAVTLSARTADFSAYNSQLAELRALGVR
IYGPGATVAQDLEPEYVTISADGRTAYVTLQENNAIATVDIASATVTAIRPLGTKDHGVA
GFGLDPSDEDGGTNTNSGTPAVQIGTWPVRGMYLPDAIASYSVGGQTYLITANEGDARAD
WPGLNEEVRIRAHCSAGLDPAVFAGATGLAADPLLNDSNLGRLRVTSLPNGNDTGKNAAG
QCNKLHAFGARSFSIWATGGTGAMTRVYDSGDEFEQRTVALPNVLFNASHDANTLDGRSA
SKGPEPESVTTAKFGNKTYAFIGLERVGGLMVYDVTTPTAPSYVTYLNSRDATTGDRGPE
GLVFVPAAQSPNGKPLLIVGNEVSGSTAVLQVNLAY
Download sequence
Identical sequences B1Y1L1
gi|171059889|ref|YP_001792238.1| 395495.Lcho_3215 WP_012348220.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]