SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171060409|ref|YP_001792758.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060409|ref|YP_001792758.1|
Domain Number 1 Region: 936-1036
Classification Level Classification E-value
Superfamily Cadherin-like 1.6e-28
Family Dystroglycan, N-terminal domain 0.009
Further Details:      
 
Domain Number 2 Region: 1966-2066
Classification Level Classification E-value
Superfamily Cadherin-like 2.67e-28
Family Dystroglycan, N-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 3180-3280
Classification Level Classification E-value
Superfamily Cadherin-like 2.82e-28
Family Dystroglycan, N-terminal domain 0.016
Further Details:      
 
Domain Number 4 Region: 2877-2977
Classification Level Classification E-value
Superfamily Cadherin-like 4.39e-28
Family Dystroglycan, N-terminal domain 0.026
Further Details:      
 
Domain Number 5 Region: 2168-2268
Classification Level Classification E-value
Superfamily Cadherin-like 5.73e-28
Family Dystroglycan, N-terminal domain 0.01
Further Details:      
 
Domain Number 6 Region: 3584-3684
Classification Level Classification E-value
Superfamily Cadherin-like 5.96e-28
Family Dystroglycan, N-terminal domain 0.01
Further Details:      
 
Domain Number 7 Region: 2269-2369
Classification Level Classification E-value
Superfamily Cadherin-like 6.43e-28
Family Dystroglycan, N-terminal domain 0.026
Further Details:      
 
Domain Number 8 Region: 3382-3482
Classification Level Classification E-value
Superfamily Cadherin-like 8.16e-28
Family Dystroglycan, N-terminal domain 0.011
Further Details:      
 
Domain Number 9 Region: 3079-3179
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-27
Family Dystroglycan, N-terminal domain 0.017
Further Details:      
 
Domain Number 10 Region: 1863-1965
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-27
Family Dystroglycan, N-terminal domain 0.013
Further Details:      
 
Domain Number 11 Region: 2978-3078
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-27
Family Dystroglycan, N-terminal domain 0.013
Further Details:      
 
Domain Number 12 Region: 3281-3381
Classification Level Classification E-value
Superfamily Cadherin-like 1.46e-27
Family Dystroglycan, N-terminal domain 0.019
Further Details:      
 
Domain Number 13 Region: 1178-1471
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.78e-27
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.019
Further Details:      
 
Domain Number 14 Region: 2370-2470
Classification Level Classification E-value
Superfamily Cadherin-like 2.04e-27
Family Dystroglycan, N-terminal domain 0.011
Further Details:      
 
Domain Number 15 Region: 2574-2674
Classification Level Classification E-value
Superfamily Cadherin-like 2.67e-27
Family Dystroglycan, N-terminal domain 0.011
Further Details:      
 
Domain Number 16 Region: 3685-3785
Classification Level Classification E-value
Superfamily Cadherin-like 2.67e-27
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 17 Region: 2776-2876
Classification Level Classification E-value
Superfamily Cadherin-like 2.67e-27
Family Dystroglycan, N-terminal domain 0.012
Further Details:      
 
Domain Number 18 Region: 2067-2167
Classification Level Classification E-value
Superfamily Cadherin-like 5.02e-27
Family Dystroglycan, N-terminal domain 0.011
Further Details:      
 
Domain Number 19 Region: 3483-3583
Classification Level Classification E-value
Superfamily Cadherin-like 5.02e-27
Family Dystroglycan, N-terminal domain 0.011
Further Details:      
 
Domain Number 20 Region: 2471-2573
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-26
Family Dystroglycan, N-terminal domain 0.033
Further Details:      
 
Domain Number 21 Region: 835-935
Classification Level Classification E-value
Superfamily Cadherin-like 2.04e-26
Family Dystroglycan, N-terminal domain 0.011
Further Details:      
 
Domain Number 22 Region: 2675-2775
Classification Level Classification E-value
Superfamily Cadherin-like 2.2e-26
Family Dystroglycan, N-terminal domain 0.011
Further Details:      
 
Domain Number 23 Region: 4094-4188
Classification Level Classification E-value
Superfamily Cadherin-like 1.65e-17
Family Dystroglycan, N-terminal domain 0.035
Further Details:      
 
Domain Number 24 Region: 1773-1863
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000275
Family Cadherin 0.0096
Further Details:      
 
Weak hits

Sequence:  gi|171060409|ref|YP_001792758.1|
Domain Number - Region: 1054-1140,1556-1572
Classification Level Classification E-value
Superfamily Sialidases 0.000549
Family Sialidases (neuraminidases) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|171060409|ref|YP_001792758.1|
Sequence length 4231
Comment outer membrane adhesin-like protein [Leptothrix cholodnii SP-6]
Sequence
MSSTPNNKSWKKHHTAPAPRAWALEARLMFDAAAVADAVHQLSAETDTHVLDLQASSAAQ
TTTASAVETTPHPIEGLFRIATAPGDVAPTLLASQAEAQRLLQEFAQRPDAREQLFALFN
GNQAEPSAEWTRAADAYLAALRSGEVSIEVQLRSAADLKGNMGAFSVDGADGQPVIYLNA
DWVASGVATDALTRVLAEEFGHGIDHALNGSTDTTGDEGEAFAAVALNLGLDPTQQQRIT
AEDDHTSLVLDGHALTVELAGTAEVSVPFSEGYIGTVGTSTGKANNILNFSTLGITRASF
FQDSTTGSFGGTQGNDLSGGIRLTLASGQVITINGAINWRDTAGSTLYAFGFIPDPATPN
IAISYGSGQTYTITSSSNFGLETIGVTYSVADGSNVSGNAATSGLLTSLNTYLAEVQASA
PGGPVTVTSLSTSDSTPTLGGTATLGANETLTVIVNGTTYTTSTGLTLGAGSTWSLTIPD
AKLLANATYGVTATITNASGYTLTDTTSSELIVNTALPSNVAPTADAVSTSGTEDAASIT
VALSATDSDGTVASYTIATLPANGTLYTDAARTQAVLAGTPFSTSTLYFVPTAHWNGSTS
FGYVATDDGGASSTSTTASITVSAVNDAPVVLDDAQTTAENTVLHASVVPATDVDAPPEI
QDTGTLDFTIANRTFSFFGPETGSNEFNVNVGSGPTGFGSAAAMAAAFQAHPNYALLPYT
IGVNAAGDGLQLDFKVSGNYGGRGLEKWGDGPSWLTTLREGQDLVYSVVTDVPAGQGTLS
FNADGSYDFDPGTAFDDLAPGASRSTTFTYTATDPDGSAAVARTVTITVTGANDAPTVAA
SLADAAATQGTGFSHTVPAGAFADVDVGDTRSYTATLADGSALPAWLSFDAATRTFSGTP
ANADVGTISVKVTAFDGSSATADDTFDIVVTDVNDAPSVANPIADQAATEDSPFSFTVPA
NAFADVDVGDTRSYTATLADGAALPAWLSFDPATRTFSGTPANADVGTISVKVTATDSGQ
ATADDTFDIVVANVNDTPVLADTPLALTVAEDAGTPVGAVGSLIGAFTGGSSDADTGAAK
GIAITGADTSKGSWYYTTDGGANWQALGAVSATSARVLADDGNTRLYFKPAAHANGDVTA
GLTFKAWDQNGGHANGTANVDTLGGAALIGGYNTPGTSFDVKLSADGTKAFVADTSGGLQ
VIDVSNPAAPTVLGSYGNASTYFLALSADGTKAYLGNEANDFLIVDISNPASPTLLGTLV
TTGYAYEIALSTDGTKAYLADSASLKIIDITNPAAPALIGSFAEAGGGGAFFVTLSPDGT
KAFVGNTSSGLQILDVSTPAAPTLLGTYDTPGTAYTVTLSADGTKAFVADMASGLQIIDV
SNPAAPTLLGTYNTTGSAWDVRLSADGTKAYLADASSGLLIIDISNPSAPTLLGTYNTAG
SAYGLTLSADETKAYVADGASGLQIISLTTSPTEFSTATDTIAVAITAVNDAPVATGNAT
LAAIAEDTPNPAGATVASLFGANFSDSTDQVSGGSSAHTLAGIAITGYTVDAAQGAWQYS
TDSGAHWTSVPGIGAETGAFTLQAATLLRFLPAADYNGPAPTLTTRLIDSSTTVADAATL
DASTHGGSTALSDATVALNSSVTAVNDAPLLTGDLAASVAVGNRYTITSGDLGYTDPDDG
NADITFTVSALGNGSIEVDGTSATQFTGTQLAAGQVRFVHDGSNTTSASFSVRVEDGNED
SSTPADSTFNLIVTPVNVAPVITSHGGDATASVNYAENGSTAVTTFTATDADSGDTRTFS
ISGGADAALFDIGASTGALTFKASPDFEGTGDNSYDVTVKVADAAGAFDEQTLTVQVTNV
NEAPTLVNAIADQAATEDSPFSFTVPADAFADVDVDVGDTRSYAATLADGSALPAWLSFD
AATRTFSGTPANGDVGTISVKVTATDGSNASADDSFDIVVANVNDAPTVANPIADQAATE
DSAFSFTVPADAFADVDVGDTRAYTATLADGSALPAWLSFNPATRTFSGTPANADVGTLS
VKVTATDGALASADDSFDIVVANVNDAPTLAHAIADQAATEDSAFSFTVPADAFADVDVG
DSRSYAATLADGSALPAWLSFDAATRTFSGTPANADVGTISVKVTATDGSNAFADDSFDI
VVADVNDAPAVANPIADQAATEDSAFSFTVPADVFADVDVGDTRSYVATLADGSALPAWL
SFNPATRTFSGTPANADVGTISVKVTATDGSNASADDSFDIVVADVNDAPAVANPIADQA
ATEDSPFSFTVPADAFADVDVGDTRSYAATLADGSALPAWLSFNAATRTFSGTPANADVG
TISVKVTATDGALASADDSFDIVVANVNDAPTLVNAIADQAATEDSPFSLTVPADAFADV
DVGDSRAYTATLADGSALPAWLSFDAATRTFSGTPANSDVGTISVKLTAFDGALASADDS
FDIVVADVNDAPTLVNAIADQAATEDSPFSFTVPVDAFADVDVDVGDTRSYAATLADGSA
LPAWLSFDATTRTFSGTPANGDVGTISVKVTATDGSNVSADDSFDIVVANVNDAPTVANP
IADQVATEDSLFSFTVPADAFADVDVGDSRSYAATLADGSALPAWLSFDATTRTFSGTPA
NADVGTISVKLTAFDGALVSADDSFDIVVANVNDAPTLAHAIADQAATEDSPFSLTVPAD
AFADVDVGDSRSYAATLADGSALPAWLSFDAATRTFSGTPANADVGTLSVKFTATDDSNA
SADDSFDIVVANVNDAPTLMNEIADQAATEDSPFSLTVPADAFADVDVGDSRSYAATLAD
GSALPAWLSFDAATRTFSGTPANGDVGTISVKVTATDGSNVSADDSFDIVVANVNDAPTV
ANPIADQAATEDSPFSFTVPADVFADVDVGDTRAYTATLADGSALPAWLSFDATTRTFSG
TPANGDVGTLSVKVTATDGSNASADDSFDIVVANVNDAPTLMNEVADQAATEDSLFSFTV
PADAFADVDVGDTRAYTATLADGSALPAWLSFDATTRTFSGTPANGDVGTLSVKVTATDG
SNASADDSFDIVVANVNDAPTVANPIADQAATEDSAFSFTVLADAFADVDVGDTRAYTAT
LADGSALPAWLSFDAATRTFSGTPANGDVGTISVKVTATDGSNASADDSFDIVVANVNDA
PTVANPIADQAATEDSAFSFTVPADAFADVDVGDTRAYTATLADGSALPAWLSFNPATRT
FSGTPANADVGTLSVKVTATDGALASADDSFDIVVANVNDAPTLAHAIADQAATEDSAFS
FTVPADVFADVDVGDTRAYTATLADGSALPAWLSFDATTRTFSGTPANGDVGTISVKVTA
TDGALASADDSFDIVVANVNDAPTLAHAIADQAATEDSAFSFTVPADAFADVDVGDSRSY
AATLADGSALPAWLSFDAATRTFSGTPANADVGTLSVKVTATDGALASADDSFDIVVANV
NDAPTLAHAIADQAATEDSAFSFTVPADAFADVDVGDSRSYAATLADGSALPAWLSFDAA
TRTFSGTPANADVGTISVKVTATDGSNAFADDSFDIVVADVNDAPAVANPIADQAATEDS
AFSFTVPADVFADVDVGDTRSYVATLADGSALPAWLSFNPATRTFSGTPANADVGTISVK
VTATDGSNASADDSFDIVVADVNDAPAVANPIADQAATEDSPFSFTVPADAFADVDVGDT
RSYAATLADGSALPAWLSFNAATRTFSGTPANADVGTISVKFTATDGSNASADDTFDIVV
ADVNDAPTWSDVDTAATAALTAQDTAVTGVLPAAGDTEGDTLSYGKAADPAHGSVTVSAD
GHYVYTPSAGFHGTDSFEVSVDDGHGGRSTLTVRVTVLPAPTLGLPAGSDLGSSSTDRIT
SAAVITLDGAAAAGQTLRLYGPQGQLIATVATDAQGRWSADRIDLSGMQGDDAGAVKGAA
GRYSFSVRMVLPSGVESAPTPLTVTREIPLVIEAAAAPAPAPIPEVAAAEPAAAPAAAPQ
PAFDSALVSTPVTAPVASSTEAPRASTPPVTGRDESVAPPQTPTQRSSADGDIYTRSSGF
QVMVTPSSEPSLKLFNGVQDQVVPMNRLLIVQVPADAFVHTVLAETVTLSASRADGTPLP
AWLSFDSRSGKFVGEPPAGQAQDLAIRITARDTQGREATTMFRVKVTEAAGNGVSGRASF
NQQLARGEALVFKPGQRAWQAQPRPAVMRRG
Download sequence
Identical sequences B1Y5U7
gi|171060409|ref|YP_001792758.1| 395495.Lcho_3739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]