SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|171060980|ref|YP_001793329.1| from Leptothrix cholodnii SP-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171060980|ref|YP_001793329.1|
Domain Number 1 Region: 35-201
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.9e-27
Family Astacin 0.045
Further Details:      
 
Domain Number 2 Region: 237-336
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000248
Family Collagen-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171060980|ref|YP_001793329.1|
Sequence length 340
Comment peptidase domain-containing protein [Leptothrix cholodnii SP-6]
Sequence
MAAPKCCFDRILPRDLLRPQATLAGPGGRTRAISPKGKTWINGSTLRVRFMGGTAAEQAR
TREQAGWWSAVCNLKFDFGNAPEAEIRISYDGNDGAWSMLGTDARSIPFNQATMNLGFMD
GGTAAHEFGHAIGLAHEHSSPAGGIQWNEQAVIRSLAGPPNFWDEATTRHNVFFKYGMDQ
INGTQFDPDSIMLYAFPAEWTLNGVATHANEVLSALDREFVAGARMYPKTQPGLPAATPL
TVGASRISASIGKAGEEDLFRFHADTNGVYVIETMGITDVYMKLFGPNSATALLAEDDDS
GFGLNPRISAPLLAGDYFVQVRHYDRSGGTGRYSVGVKRR
Download sequence
Identical sequences B1XZK1
WP_012349305.1.27902 gi|171060980|ref|YP_001793329.1| 395495.Lcho_4313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]