SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MAPG_00528T0 from Magnaporthe poae ATCC 64411 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MAPG_00528T0
Domain Number 1 Region: 372-421,457-540
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-20
Family Ran-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MAPG_00528T0
Sequence length 542
Comment pep:novel supercontig:Mag_poae_ATCC_64411_V1:supercont1.1:1643647:1646413:-1 gene:MAPG_00528 transcript:MAPG_00528T0 description:"hypothetical protein"
Sequence
MADDSHNTSEVIDAVGAESPKEDAATKATREELKHTVISDTPADTAASTAMDEDKNDRAP
SAGDKTPDLKPSSVAAALKEQVSSPKKKRAHDEVEEGQEVSISPALSGCSSPRDSNGVSR
GERLEPEKKRARDEPEEETKKSVDQTSAATTTSKNTADSEPKDATKTPVSATEKADDQQS
ISTSEKDGAAAKPSSTSTSASAFAKSGFAKLTGAASPFGALGAGAAKSGGFGGSLSSSPS
PFGALGTGPTPANTVPKLTFATPAADGSGPAAAASPFAALNGGSSKTFGSAFGSGFGSGF
GASKLTSFAKPGGDLKDTKPARPFGAPESDNEGSSDEGDDDEEPEIGTEEPEPEKEPEES
KQAAATAEDKKKTKLQKVVVDDGEAGETTVFVARAKVYYMDSVANAWKERGAGLLKINVP
EATVDADDHGAVVPESFDASMLQGDDEGDDVEAGGSTAAKGSKVVRLIMRQDHTHRVVVN
TAVTAATDFVKREMLRAATFTFSAVEGPQATRVTLQIKMSPPNAEQFHKVIELIQKELKS
LG
Download sequence
Identical sequences A0A0C4DL88
MAPG_00528T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]