SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MAPG_06445T0 from Magnaporthe poae ATCC 64411 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MAPG_06445T0
Domain Number - Region: 897-924,1078-1156
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.017
Family Pseudo ankyrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MAPG_06445T0
Sequence length 1619
Comment pep:novel supercontig:Mag_poae_ATCC_64411_V1:supercont1.5:1804564:1810315:1 gene:MAPG_06445 transcript:MAPG_06445T0 description:"hypothetical protein"
Sequence
MADDTGQAVAVKTLSLAEEAWRQSLAEFFGGDPGSVEETLLKLENLEDMLGEAHNAKASH
DAKQLTFEFRGGRYAYIDIFGQVVRHINALKGVIDSGVALDVSGQAALPWAVVKFILGFL
GNYHDQKDAVLSSLASVDHVLVYYRQFESLYFRNQASAAGRHREPTQSPTEDLKSAILEV
YSQCFRILRDTTEWFGQSADKARKGWKDSEKTDARKTALKRSLRNLQDWARKTGKTANKI
FGSSARYSDGVAKIEAGRAKVDMWANLVMRQDQLRAMDLTDRTHALVEKIEHAAFLRGLS
DISSLKEHAALSETILMGSAIWFPRNSKYQEWLMSPKPAALWIHGSLGSGKSTLVCLAID
GFLEGLRPNPTAPVVFFYGVVHSEDGSTWTTRTADDCARDMLRQLVQLNPSSGLPELSSY
VEGNKPSGKTCLKLIEEIIDASAYVSVTFAIDALDRMTLPRGRNSRVALTPGALLDGLVK
LSLSKAGKCLVRILVSSQHRDDIPKSVFEDKKDAAIRVVEIDVDSESPPTIRQFIESQVS
GWIRADFLPGEAGEEGEKARKRARAAVVESVTLHAGRMYLWAQLTLNNIRGNQKLKKETD
LLDELKKLKSPSDITKMYKAIWGGLSGDSRATRVLQLLCCAGKRVATAAVLGALGGADKC
TADDIVKSSGGFITEDHKHGVLALFHPSVKQFLGEQAGYEAQAHTAVAEMCLSTLSEFYQ
DRSQGRRGRSRERQGASSDARRRRSRMRSRSGSRRRGQTRDGLEDPQRKPPGRRQRQRGA
GLEGRDCYDHVLQDFNEYADIYWATHASKSGDPSLGERVARFLGTVHERELWIESAQTRL
SQRPHGFYGHVVEQELKHCWSSHPATSLLVSAVYGFATFIEGEVARAARDSRIRTFEDLR
NDDGLSTFHLAAKFGHIPVLNLLARLTPTPAIFLEPDEKGNNTTAMEYALRNLRTAPEPR
DLEAWLKLKARSGFKVWWVERLKEWYYSNGDREVAFIRECRLVAAALQNPFCAQELLELL
RPKLKMLSSGELPDMEADAVDKGSCREAYQILLQAAVQYAGCSVELLRQGLSMCDKHVTE
AVLVAAARWRNTERVPWRSRRPVWDYLVSGTGTQRLTREVIRAAIKAGDADLTRYLLELV
PQLVLSPEMLEHAVTHRWEALRLIKALLDTTPGEKMIRRVRIITASMLEAMSGNQEQGGE
LLRTLREMSPSAAGDTTEPDLILKTAFRTGNWPFLEELVQTPSRKPRPSYEKVASALVES
LAQPFCVSEASSYALYRPENQRDKQCEAAVSRIVDHFMDGKWEGLDGIPPLAEYQGPAVM
KRLLALAEFDDTALASLLAAAACNKTYGLDIFKLVTQVSNGKVGKLLEHNDLHVVKQVIS
RGHWQVFEHIQKEHADILAVVPEPDLRNAASNPDVRVARFIFSSPIVTGRPALTVEMADL
VRAALNSDAVLDCLMGMPDAPEYRPLRLLKAIAEGCGRTVSLRRALEESGRNRKQPSSRY
IFVDLAHAAIGNKHGIDMLTFVLLLSSVGVTAGMLERAAANRTAAPEMLRVLLNRCEDDR
VSRLITTRVRRAAERNTVSGLEALRILRMEEDFENERKRKERGRKGEIALNVLLQRKLQ
Download sequence
Identical sequences A0A0C4E219
MAPG_06445T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]