SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|182440199|ref|YP_001827918.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182440199|ref|YP_001827918.1|
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000185
Family Tetracyclin repressor-like, N-terminal domain 0.0074
Further Details:      
 
Weak hits

Sequence:  gi|182440199|ref|YP_001827918.1|
Domain Number - Region: 72-165
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00431
Family Tetracyclin repressor-like, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182440199|ref|YP_001827918.1|
Sequence length 175
Comment TetR family transcriptional regulator [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MAERLAGEEGCAAVTVRSVCREARLTDRYFYESFTGRDDLLLAAFERVADEARGALEEAV
ALSDPQRDIRAGAVVSAFVALVLDAPHKGRLLLLEPFADPALGAHSHRLMPVFTDLVGGQ
LAGTGDDIDRRMAAHALVGALANLFAGWLHGTLDVPRERLEAHCVELVLAATSRE
Download sequence
Identical sequences B1W5S8
gi|182440199|ref|YP_001827918.1| 455632.SGR_6406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]