SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|182439634|ref|YP_001827353.1| from Streptomyces griseus subsp. griseus NBRC 13350

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182439634|ref|YP_001827353.1|
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Cgl1923-like 3.79e-88
Family Cgl1923-like 0.000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|182439634|ref|YP_001827353.1|
Sequence length 350
Comment hypothetical protein SGR_5841 [Streptomyces griseus subsp. griseus NBRC 13350]
Sequence
MIELESVPELIDPVMVAAFEGWNDAGDAASTAVGHLDREWKGEVFAALDAEDYYDFQVNR
PTVWLDGGTRKITWPTTRLSVVRVGGDKPRDLVLVRGIEPSMRWRSFCNEILGFAHELGV
EMVVILGALLGDTPHTRPVPVSGVTSDADLARTMDLEETRYEGPTGIVGVLQEACTHAGV
PAVSLWAAVPHYVSQPPNPKATLALLNRLEDLIGLRIPLGELPEDARAWQLGVDQLASED
SEVAEYVQTLEEARDTAELPEASGEAIAREFERYLRRRDGGPGQGPGGHATESGDIPYLR
DPATGRTRPPKPPRTEPGRGRDADGQGAEGPDETPGKDPGNGSGETPDED
Download sequence
Identical sequences B1W2Y8
WP_012381569.1.20467 WP_012381569.1.29035 WP_012381569.1.58927 WP_012381569.1.60218 WP_012381569.1.6712 455632.SGR_5841 gi|182439634|ref|YP_001827353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]