SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|167644856|ref|YP_001682519.1| from Caulobacter sp. K31

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167644856|ref|YP_001682519.1|
Domain Number 1 Region: 4-44
Classification Level Classification E-value
Superfamily Bacterial aa3 type cytochrome c oxidase subunit IV 0.00000000000209
Family Bacterial aa3 type cytochrome c oxidase subunit IV 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167644856|ref|YP_001682519.1|
Sequence length 76
Comment aa3 type cytochrome c oxidase subunit IV [Caulobacter sp. K31]
Sequence
MAGDYQRGEMDIHEQAATFEGFGKMTKWGSLAIAVLLLTITLWFCTSAGFIGGVIPGIVL
AVLGVVFLREKPAAAH
Download sequence
Identical sequences B0SVI2
WP_012284956.1.20905 366602.Caul_0890 gi|167644856|ref|YP_001682519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]