SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170738597|ref|YP_001767252.1| from Methylobacterium sp. 4-46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170738597|ref|YP_001767252.1|
Domain Number 1 Region: 333-503
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-37
Family Histidine kinase 0.0039
Further Details:      
 
Domain Number 2 Region: 522-634
Classification Level Classification E-value
Superfamily CheY-like 1.57e-29
Family CheY-related 0.0039
Further Details:      
 
Domain Number 3 Region: 20-151
Classification Level Classification E-value
Superfamily CheY-like 2.7e-28
Family CheY-related 0.0023
Further Details:      
 
Domain Number 4 Region: 135-259
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000168
Family Heme-binding PAS domain 0.029
Further Details:      
 
Domain Number 5 Region: 264-339
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000133
Family Homodimeric domain of signal transducing histidine kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170738597|ref|YP_001767252.1|
Sequence length 640
Comment PAS/PAC sensor hybrid histidine kinase [Methylobacterium sp. 4-46]
Sequence
MITDETNLRRGMDREAARGTILAVDDEPDILVALEDLLEDEFRVLTASRPADALALLAAE
PDVAVIVSDQRMPGMTGDALLARAREVSDAQAILLTGYADLSAVTSALNRGGITGYVTKP
WDAALLRGAVRAAYERCRLGRDLATERALLRGLLDHAGDAIAFKDPQGRFVRLNAAKAAR
LGAAVEDCLGEPESRFLDPETAARVEAADREAAAGLHPVEATIAGGPAAAPTWTQVVRVP
IRDAHGALAHLATIERDVTEQKQLEARLRQADKMQALGTLAGGVAHDFNNLLTAIMGSLE
LALPKVAGDARLTRLMTNAAQAAQRGAALTKRLLSFSRQRDLQARVVDLNGVIRGMDDLL
GRSLGGFVQVDHALAPDLWPARVDPEQLELAILNLCINGRDAMPDGGIVTLSTRNVVVAG
SPDPDLPDGDYAVIAIADTGTGIPPEILSRVFEPFFTTKAQGQGTGLGLAMVFSLLQQSG
GTIRIDTEVGRGTRVDLYLPRAHEPVETDEARAGAAVPPRRRARILVVDDDPQVRHVTAS
FLSGFGHEAVEVPEAEAALARIEAEPFDLVVADLAMPGMTGLDLAEAVRGRRPDLPFLIV
TGHAEAARIPHAYAVLEKPFPSGELGTRVAALLADAPERR
Download sequence
Identical sequences B0UFG4
WP_012330236.1.41957 426117.M446_0247 gi|170738597|ref|YP_001767252.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]