SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170739232|ref|YP_001767887.1| from Methylobacterium sp. 4-46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170739232|ref|YP_001767887.1|
Domain Number 1 Region: 17-252
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.26e-33
Family Nuclease 0.025
Further Details:      
 
Domain Number 2 Region: 263-421
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.93e-20
Family Nuclease 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170739232|ref|YP_001767887.1|
Sequence length 478
Comment phospholipase D/transphosphatidylase [Methylobacterium sp. 4-46]
Sequence
MRMDDALAGAVPVAPPPTLFVPGRNCWRVARAARAALLVDGADYFAALEDALARARRSIT
LVGWDFDGRIRLRADAPEAASPPLGPFLRALVEARPELELRILIWSVGTLHGPGEALPLL
FGAEWQRHPRIRVRLDTRHPLYAAHHQKIVCVDECLAFVGGMDLTVQRWDTQEHRAEDPR
RVDPDGAPYGPVHDTQMVVDGEAARAVGDLVRARWRDATGEAAAPAEGPPLWPRGLAPDF
TDVPVAIARTMPLLDEQPSVEEAAALTADLLRGARRHVYIEAQYLTARFVGDVLEAQLAR
PDGPDVVIVLTRRSHNLTERVAMGAPRDRLIRRLRAADRHGRFLLAYPAVPGPAGECQVL
VHSKLVIVDDTALRVGSSNLNNRSVALDTECDLAVGGTDPATRATIAALRDRLLAEHLGA
DPAAVTAAIRAEGSLVRAVERLNTGPRGLRPFAVPPEEGLIEPLLGADLLDPERPFGS
Download sequence
Identical sequences B0UB72
426117.M446_0903 WP_012330870.1.41957 gi|170739232|ref|YP_001767887.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]