SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170744480|ref|YP_001773135.1| from Methylobacterium sp. 4-46

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170744480|ref|YP_001773135.1|
Domain Number 1 Region: 376-541
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.17e-41
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 27-168
Classification Level Classification E-value
Superfamily CheY-like 1.57e-33
Family CheY-related 0.0025
Further Details:      
 
Domain Number 3 Region: 564-679
Classification Level Classification E-value
Superfamily CheY-like 1.85e-25
Family CheY-related 0.0071
Further Details:      
 
Domain Number 4 Region: 174-302
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000209
Family Heme-binding PAS domain 0.026
Further Details:      
 
Domain Number 5 Region: 315-382
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000471
Family Homodimeric domain of signal transducing histidine kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170744480|ref|YP_001773135.1|
Sequence length 688
Comment multi-sensor hybrid histidine kinase [Methylobacterium sp. 4-46]
Sequence
MSEDRAPALPGPDPAGGPAADLPPIRVKILIVDDDRRNLLAVSEILDEPGLDLVLAESGE
DALRHTLRDDFALILLDVQMPRMDGYEVASLIRSRSRSSRVPILFLTAYNREEMHVFRGY
SAGAVDYVFKPIQPLVLKSKVSVFVDLHRKTEEIKLKASAEKKLLLENLRVRGEKLEAER
ALRRRDAHQAAVLRGLPIALYTASHQGDHRRLRFTNESVERVSGFGAEAFADPGLWLSRL
NPEDRDRVLDALRAVGRTGAATLEYRWRHADGSERHILDQVVANRGEEAAPGEVFGMWFD
ITERKEMELSLVHASKLEAVGRLTGGVAHDFNNMLSIVIGNLDLLQKSLVADEKAHQRVQ
NAIDGAQRCAELTSRLLAVSRRSPLQPAPLDLGSFMPGLVQLLRRTLGERIGVTLDLGDA
PPAVSVDRSQLEAALINLAVNARDAMPEGGHLSIAVRRAGEADRAGRAADAVLISVADTG
TGMPASVLARVFEPFFTTKAEGKGTGLGLSMVHGFLQQSGGHIDVESVPGQGTTFTMSLP
ILAEAGPGTPAAPGAAPPDEVSGEGRTVLVVEDDSEVRQVAKAALKTLGFHVEEAGNGDE
AVAMLEENSDVALVLSDVNMPGTISGIELGRIVRQRWPNIGIVLASGYLKEGQDTECFVT
LQKPYRTSELIEKLAGLVAPKAEAAIPA
Download sequence
Identical sequences B0UB09
426117.M446_6442 WP_012336077.1.41957 gi|170744480|ref|YP_001773135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]