SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169794680|ref|YP_001712473.1| from Acinetobacter baumannii AYE

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169794680|ref|YP_001712473.1|
Domain Number 1 Region: 35-260
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.28e-43
Family Phospholipase D 0.047
Further Details:      
 
Domain Number 2 Region: 332-507
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.42e-29
Family Nuclease 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169794680|ref|YP_001712473.1|
Sequence length 543
Comment phospholipase D [Acinetobacter baumannii AYE]
Sequence
MIMAQSFHSKQLQTHQLAKGFLIKASIVVCSSFAVALTGCSTLPKHSPEPIQYARDIDTS
QTSLSKIITPLREKNPNLTGYHLLNDPLEALAARLRLIDKAEKTLDLQYYIWDNDKVGAL
ALHAIIRAADRGVKVRLLIDDNNAKKMEGVLLALSQHKNIEVKLFNPYRFRKYRAMDMIL
DLKRINRRMHNKSFIADNQVALIGGRNMTNQYYNVSDSYQFSDVDVMLVGAAVDDIVNSF
DDYWNHEYAYSVQSIVSAQQHRLRYESLKQQLDAHYQQATVQNFLDLTSRSHAFDKWLDS
NIKFDWVKAEVVKDSPDKIRSKAKKEEHLNFQLINHLEKPESNVDLISAYFIPEKQGAKI
LSTLAKEGVEVRVLTNSFKANDVAVVHAFYGKYRKELLKNGVQLYEFLPTPDKRDLNKNT
DELATKAKVNMKGLSRSSLHTKLMALDEQVFIGSFNFDPRSAYLNTEIGVILDSPSLAKT
IHHTMDENLNKYAYKLKLDPDNHIYWQQETPKGPIIYKKEPEMKWWQKAGMKLLSWLPLE
GFM
Download sequence
Identical sequences B0V657
509173.ABAYE0498 gi|169794680|ref|YP_001712473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]