SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170289645|ref|YP_001736461.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289645|ref|YP_001736461.1|
Domain Number 1 Region: 9-236
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-47
Family Protein kinases, catalytic subunit 0.00051
Further Details:      
 
Weak hits

Sequence:  gi|170289645|ref|YP_001736461.1|
Domain Number - Region: 305-350
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00845
Family FHA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170289645|ref|YP_001736461.1|
Sequence length 367
Comment serine/threonine protein kinase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MNRGSLGKVDKYTLIRMLREGGFSKVFLARRERELVVVKLPKDDELSRYLLAEEAEILEE
VSKPVPHENIVGFIEWIPEASALVEEYVPGPTLREAFSGRIATQGDAIRVALGCLSALER
IHSLGIAHGDIKPENIILPKPLHPVLIDMGVARRFGSKSLAATLGWSAPEFLKGEVSPES
DIYSVGALLLFMLTGRDPPEDPSSIKVPNNISDNLKYVLERSLNPEPWGRFGSASEMSLA
LMGRKLPQGEGPRLVIQGKVINLTSKITIGRIKRQGGTGNADVCLQEIGNRRLLPPGPPL
GWVEISKVGGEFWISDMGAPGGVWIQEGMSWKRVMDYPLKHGQLISIGLRVKGRMALPYV
LGRFYSR
Download sequence
Identical sequences B1L7F1
WP_012308675.1.97847 374847.Kcr_0018 gi|170289645|ref|YP_001736461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]