SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170289732|ref|YP_001736548.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289732|ref|YP_001736548.1|
Domain Number 1 Region: 28-83,227-449
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.91e-48
Family FolH catalytic domain-like 0.016
Further Details:      
 
Domain Number 2 Region: 119-243
Classification Level Classification E-value
Superfamily PA domain 0.0000000000000615
Family PA domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170289732|ref|YP_001736548.1|
Sequence length 719
Comment peptidase M28 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MRAVTLALISLLLLSLLPASAEEEKVIGKIDIEYAKYIENKLTSIGSYKEPKFLGFRVAG
TPEDLETANFIAEEMRKMGLVNVSLEPVPLDAWEFKGARLELSNGKVIIASSFGGVPGTG
SEGISGEIVYVGDGTRGNYEGLNVSGKLVLAYWNPDISWFNMIAHEAMIHGAKGVILFNP
PNGSYAQHPNALHSFDGLYSSDFIPMIVISKEDAQEIIEMLKSGPVEAKMVNLATLKRGT
GWNTIGYIPGRRADEYILIAAHHDAWFYGAMDDTGAVAALLTLAKAIKESGYVPERTLVF
MTHTAEEYGIVDAYHDWLIGAWWRITQAHPEWRKKAIAYINLEGMAIKGVPLGVDASPEL
STFISEILDESKELLPYGRGELEDVYCWTEAWPYAAAGVPSINLDTFSPWFRQNLYHTQF
DSPEIIDWDYLGKIVSLTAKILIRLDKSELLPYDFSARAAHLRENLNETRMKQLGAEPEE
LMKGVEELEKAFSEFKNLSKNASSDVIVKVNSKLREAAYIMLSELTALDPWDNTIYPHQQ
VESDALFLSSALDALKGGDVNEALSMIESVSINWYDSFYSYEVFKRELLHKSPNYERITW
GGLGHLAPPIDLWKEYNSLREKSMANITNYDAEIRSIENHLKETKALYQERLRDIAKALS
SASSLIREANSILKSTTTQKTEVREETVTPQEAISLIPAVLISILVIVILLVIYLRRRK
Download sequence
Identical sequences B1L7N8
gi|170289732|ref|YP_001736548.1| 374847.Kcr_0105 WP_012308762.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]