SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170289744|ref|YP_001736560.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289744|ref|YP_001736560.1|
Domain Number 1 Region: 9-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.66e-70
Family G proteins 0.00000327
Further Details:      
 
Domain Number 2 Region: 468-629
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.9e-47
Family Translational machinery components 0.0000344
Further Details:      
 
Domain Number 3 Region: 260-374
Classification Level Classification E-value
Superfamily Translation proteins 2.55e-27
Family Elongation factors 0.00098
Further Details:      
 
Domain Number 4 Region: 630-724
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.06e-23
Family EF-G/eEF-2 domains III and V 0.00091
Further Details:      
 
Domain Number 5 Region: 393-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.76e-17
Family EF-G/eEF-2 domains III and V 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170289744|ref|YP_001736560.1|
Sequence length 739
Comment elongation factor EF-2 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MQKYKKVIDHLQELMRDPRNIRNIGIIAHVDHGKTTLSDNLLSAAGMISDKMAGEMRALD
YHEIEQQRGITIKAANISLYYQRDGKEFAINLVDTPGHIDFTGHVTRSLRVIDGAIVVVD
SVEEVMVQTETVTRQALEERVRPLLFINKIDRLIKELKLTPQEIQQKILRIIRDFNGLIE
AYGEPEFREKWKVKWDNDSVAFGSALHGWGLTNSIAAKKGIRFSDIVDIYNEDPEGLALR
RDIPVHEALLDMVALHVPDPIEAQSYRVERLWRDKQDEELFNALKNCDPNGPLIMGVNAV
RIDPHAGIVVTGRVFSGTLREGEDVYLINAKKKQKIQQTSIYMGPYRMRMDEIPAGNIAA
VLGLTSASSGETVVADAIKDRVISGFEAIRYVTEPVVTVSVEAKNPQDLPKLIDTLRKLT
LQDPNLVMIHNQETGEILLKGTGELHLEISLYEVRKAGLEFDVSEPTVVYRESVRGTSDV
VLAKSPNKLNRIWVTASPLNDEVVALIREGRVNERMDSRTLAKVLREEGKMDTEDARNVW
TIDEENYNLFINRTVGVQRLDEVREILRQGFMWVMKEGPLAGEPVMGVAIRLVNAMIHED
PAHRGPAQLTPAVRKAIFGAMLSANPVLLEPIYEIQVSTPPELIGSVISLISQKRGKVVG
IEERGRISIVKGFIPVRETLGGFSNEMRSMTSGRAFWQTKFSHWEPLPKSLMEQVALEIR
RRKGMKEELPKAEEYMDTL
Download sequence
Identical sequences B1L7Q0
WP_012308774.1.97847 gi|170289744|ref|YP_001736560.1| 374847.Kcr_0117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]