SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170289779|ref|YP_001736595.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289779|ref|YP_001736595.1|
Domain Number 1 Region: 80-233
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.19e-27
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.0017
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 8.6e-17
Family Ferredoxin reductase FAD-binding domain-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170289779|ref|YP_001736595.1|
Sequence length 263
Comment oxidoreductase FAD/NAD(P)-binding subunit [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MRIIESEKLSEKVKKIVLEGNLGSSPGQYAMIWVPKVGEIPISIAREPKGETWILVAKVG
KVSSAIHSLRIGEELWVRGPYGRGFSLRGGKCCLIGGGYGIAPLISLSERLGEMGNAKIR
FYAGFKRREDVLLEDLLSSISDELIITTEDGSYGLKGRVVELVDFDWPEAIYSAGPEAML
VEVVREAIKRGIYAEVSMERLIRCSIGICGSCSLDPLGLLVCRDGPVFDARTLSMTEDFG
RYWRGFDGRKLQIGGESIGMLLR
Download sequence
Identical sequences B1L383
gi|170289779|ref|YP_001736595.1| WP_012308809.1.97847 374847.Kcr_0152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]