SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170289879|ref|YP_001736695.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289879|ref|YP_001736695.1|
Domain Number 1 Region: 43-179,207-226
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-26
Family ATP-dependent protease Lon (La), catalytic domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170289879|ref|YP_001736695.1|
Sequence length 631
Comment peptidase S16 lon domain-containing protein [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MRKIFAMLLILMLIPLIPSTAERSRAFLRVPAVYQTPDGLLSGTLGNLTVEVEKGEGIVY
FSAEPLTQIDTQGAARTAALVASYLLGIDPKSMNFYYRLESGSTVVGGPSAGAAMTVATV
AAILGKQVRQDIIITGMINLDGIIGPVGGIPQKLEAAARAGAKMFLVPAGQEIVEETVPK
QVRIGPLILTTVEKRKVNISELGAKLGVKVVEVSTIEDALNYMLGLKIERPSTERPEIPK
EVKELLSKWVRNYLNQSEAIRGSVRSEVGKLGALSKRVINSILSDSENYSSSARDEMAKG
NLYTAASYAFQSVVEADYARSLLNYALRGEDAVNELMRRADSKLKEVGERLNSTKPQDLS
GVEAIIASKARYYDAKNALKRAADLASKGSYLDSMDWGAIHYLTYAYWRADSASNWMDMM
GLSQRMQVDEIRVKEVASAILYEAESVISYSESLIEETGASSSYLKEAYSNLNDANTAFS
SGDYYGSIGLSTTALAYGIISIHEWFTSDPNAVEEAVKSSCYSSINALMSKGIIPVLALS
YSEMASSMEGSILESIAYYELASAHAHVISLLSQVSGEQIETKSSLETTSTVERVTVTQT
VKEESGIQETYLIAALILGVFLGFVVGRKSH
Download sequence
Identical sequences B1L3I3
WP_012308909.1.97847 gi|170289879|ref|YP_001736695.1| 374847.Kcr_0252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]