SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170290131|ref|YP_001736947.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290131|ref|YP_001736947.1|
Domain Number 1 Region: 25-212
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.68e-50
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290131|ref|YP_001736947.1|
Sequence length 217
Comment beta-lactamase domain-containing protein [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MILIRGDLLDKVLGTSLANVFRICCGPFESLCYLIENKAEKNSLLIDAGCPAEDIVRLIE
ERGLKLEAILITHTHFDHLLGLGEIVRATNCRALAHPMDLEMLPLYWKEDFGTLPRIEPI
EDGMRIKLGELSFLAIHTPGHTPGSTCYYSSEIGSVFTGDTLFKGAVGTLRYSGKPDYKQ
MRKSLRKLLSLPEDTSVFPGHGDPTTIGEEKNTILSF
Download sequence
Identical sequences B1L485
WP_012309161.1.97847 374847.Kcr_0511 gi|170290131|ref|YP_001736947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]