SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170290411|ref|YP_001737227.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290411|ref|YP_001737227.1|
Domain Number 1 Region: 5-197,296-325,373-439
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.65e-63
Family Bacterial dinuclear zinc exopeptidases 0.00081
Further Details:      
 
Domain Number 2 Region: 185-291
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.43e-20
Family Bacterial exopeptidase dimerisation domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170290411|ref|YP_001737227.1|
Sequence length 477
Comment amidohydrolase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MHFSVVNEFIDSRADAFFEIAIKIWEYAELGLMEFKSSELLASVLERNGFSVKRGVSGMP
TAFIASWGDGKPVIGLLGEYDALPGLSQKAVPWREPLVEGAPGHGCGHNIHGTSALASAL
AVKEAMEKLGIKGTVRFYGTPAEENFSGKVYMVRDGLFDDVDAVLSHHPSDMNAATLLSS
LAVRSCRFHFFGRASHASVSPEEGRSALDGVELMNIGVNYLREHVIQEARIHYIIERGGE
QPNIVPEYARSWYYIRAPEVDQLESIFERVVDIARGAALMSGTKVDVEILDAMYNVIPNG
PIAAKIVDNMRSLGVPELSEEERRFAEEIAKTIPIQTKENELRKSKRPGWERLIDKLIDD
EVPEPWGDGDYMMGSTDVGDVSWKAPTVEFNTATWVLGTPAHSWQSTAQSGSPLARRSLI
FASKVMSLTALDLLTDEDLLERAKEDHLRRLRGRTYKLLIPESLTPPLNFWRDQFKV
Download sequence
Identical sequences B1L515
gi|170290411|ref|YP_001737227.1| 374847.Kcr_0797 WP_012309441.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]