SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170290504|ref|YP_001737320.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170290504|ref|YP_001737320.1|
Domain Number - Region: 20-71
Classification Level Classification E-value
Superfamily SirA-like 0.00222
Family SirA-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170290504|ref|YP_001737320.1|
Sequence length 81
Comment hypothetical protein Kcr_0891 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MKIVAEINTAKRLEGCTESPVATFLRVVKELKEGEAILLILDDSAFPVKAAEALARKLGL
EFERLGREGDLERCIAFKPDR
Download sequence
Identical sequences B1L5A8
2016953192 374847.Kcr_0891 gi|170290504|ref|YP_001737320.1| WP_012309534.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]