SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170290687|ref|YP_001737503.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290687|ref|YP_001737503.1|
Domain Number 1 Region: 48-295
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.79e-17
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 
Weak hits

Sequence:  gi|170290687|ref|YP_001737503.1|
Domain Number - Region: 803-890
Classification Level Classification E-value
Superfamily Prefoldin 0.00418
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290687|ref|YP_001737503.1|
Sequence length 950
Comment hypothetical protein Kcr_1074 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MKRALALIIILLLASANTLSVYCHDFSPSEVFSLRIYSSKPMFSIPKPIVYNYTIYATGG
QGSDVVAVSTDGKVLWSQNVGGFIATPLLLVPDVPLSPTKKEAWVIALTEAPELRALDAF
NGGLRLYGVALPSTSAGIQPAYAGDGRTVFLPLQSSIQAFDVRSRSELWFKNLTFRINFL
KNLGDSLLVLGRNDLALLSPKGEIIWERKLNQRIEAFGASSSYLAILLENKTLVLMDAKK
GTHLSKMDLSNQLGYSVPSGEFQIVGGAAVLVGSSGVIYQVDLKKMEIKRSIKTWIEPVK
QPIIMENALFYFGKGLVREYHFPLGIMLSEVRIEGGIGSDPYIFKDPKNRGYGIALFDYS
GVLHLIRFPELTIKILDLKEESGGYLIEGYVCSTASSGSRESLRIYTLDKDANQVGEKAI
GSIGPGECSARFSTLLPGKGAIGLILGDFKFPPNAVIGMSNEEWTSIKPGVTVTTTTRPA
VIPSLSFESPESVIVGEKFTVRVRGINGWNFTKLTLKLTGSGIDEVTKEISSSYGEEFEA
ELESFARSVSEDTRILLIGDGSVLRDEMLYMRIEKGKIIESVESPSSLNLNESLDLNVTL
VNRYRDGEQFIVRAELGNSSDEKMTMPLAAGESQTLRFSIKPKVNGSLQLLISVLLSNGT
KIEESSKPVVVVRPPPVTQTTQNFTTTSATSAIPQIRMEYLMAAALLLLSLAVALLLMRP
RPPKKRVEVIAPIPREVPEVVETPKVEEVPEAEEYHEEIPLGWESIEEKIEAPEIPEVLP
EEVAPEIPEVPPEEAPKAVPIELMESIEREIRELNMKIEEIKSRLADIEELLGFELSPYR
LVDAESSLVTAELRLKEGNYEEAERLVNSVKQSLKVLTEEIKEAEKIFRENWGAVENRID
IMLRVWGKAPATMLTMVPPSFRIAALERFMRMHKEKKLELRGDELVLISE
Download sequence
Identical sequences B1L5U1
gi|170290687|ref|YP_001737503.1| 374847.Kcr_1074 WP_012309717.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]