SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170290871|ref|YP_001737687.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290871|ref|YP_001737687.1|
Domain Number 1 Region: 9-86,177-356
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.87e-60
Family Bacterial dinuclear zinc exopeptidases 0.00000245
Further Details:      
 
Domain Number 2 Region: 76-185
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.31e-28
Family Aminopeptidase/glucanase lid domain 0.0000732
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170290871|ref|YP_001737687.1|
Sequence length 365
Comment cellulase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MVTSPMDDELVSFFSRLSESFGPSGFESEPINLIKERYSIFSESSIRDGLGSLIFKKSGE
TEGPKVMAAGHVDEIGFIIVSIEDNGFLKFETLGGWASTTLPAQRVIVRTKRGDHVGVIT
SKPPHLMTPEERNKPIEIKDLFIDVGAKNKDQVKEMGIRIGDPVAPLAPFEVLRGGKAWL
GKAFDDRVGTLVVMEVLRNLKEGGVNHPNTYYAVATVQEEVGLRGAETAADVVNPDVFIA
VDVDIAGDSPGITSAEAPAKMGEGVSIITWDRSMIPNFKLREFVIEVAEEENIPYQLSAV
RGGTDAGRVHLHSKGVPSVVLGIPTRHIHSHSSILSPDDVEATMKLLLALIRKMDSKVVR
GFQEL
Download sequence
Identical sequences B1L6C5
374847.Kcr_1258 gi|170290871|ref|YP_001737687.1| WP_012309901.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]