SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170290942|ref|YP_001737758.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290942|ref|YP_001737758.1|
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000000458
Family Prefoldin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170290942|ref|YP_001737758.1|
Sequence length 128
Comment prefoldin subunit alpha [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MSEDNIAFLQSLYRYLLDEYNRLNLLKSDLERSIETLKALSKSSEESIGPLILPISTFIS
LFVEAAKAREVLVLMGGNVYAKMGPEEALKQMKERLEEVNEGIREVSNNLAKVQIELENA
QRMVRRAR
Download sequence
Identical sequences B1L6J6
gi|170290942|ref|YP_001737758.1| 374847.Kcr_1329 WP_012309972.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]