SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170290982|ref|YP_001737798.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170290982|ref|YP_001737798.1|
Domain Number 1 Region: 8-173,201-215
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.87e-47
Family Ribonuclease PH domain 1-like 0.00000353
Further Details:      
 
Domain Number 2 Region: 187-268
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-22
Family Ribonuclease PH domain 2-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170290982|ref|YP_001737798.1|
Sequence length 268
Comment exosome complex RNA-binding protein Rrp42 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MFDQEILTHNLMKDYIRDLVEKGQRVDGRGLHEYRPIEVLNGTFTKAEGEAWLKLGETQV
LVGVKADLGEPFPDTPDKGVFVSNAELLPVASPTFEPGPPDEGAIELARVVDRAIRSADA
IDLGSLVILPGKLVYMIFLDMYVLDYDGNLEDSLTLASLIALGRSEIPEVELKENGEIEV
KESKRKLELKDIPINFSFVKIGSKILLDPTLEEESVSDASITVAINKDGKVCSVQKRHGT
FTVEEILNIVNVARSKWPELARIVREAI
Download sequence
Identical sequences B1L6N6
WP_012310012.1.97847 374847.Kcr_1369 gi|170290982|ref|YP_001737798.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]