SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170291046|ref|YP_001737862.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|170291046|ref|YP_001737862.1|
Domain Number - Region: 62-101
Classification Level Classification E-value
Superfamily Prefoldin 0.00889
Family Prefoldin 0.013
Further Details:      
 
Domain Number - Region: 71-185
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00994
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170291046|ref|YP_001737862.1|
Sequence length 245
Comment hypothetical protein Kcr_1433 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MRGKVSGYLLSSLKEYFGDEKGEKIAEILSRSNIRCFDDLSTDIPDSLIELMEVSKSSFR
NFLEEYGPQAIAKLKERVEDLSSKVKQLETQIGWAKERIQQSIDFRSSTSLRAMRELDVA
IGILSSIVSSIQICCEKSSGIDERKAEIYSKTINEAAERLRRASDSDEEFSEQLKDAASS
LERIVEIMRELRAGDLLDLLNYTLSILSDIKRTRMRLDFDKNSLILENILLKSKIVSLLC
SRFNP
Download sequence
Identical sequences B1L6V0
374847.Kcr_1433 WP_012310076.1.97847 gi|170291046|ref|YP_001737862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]