SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170291073|ref|YP_001737889.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291073|ref|YP_001737889.1|
Domain Number 1 Region: 3-179,293-365
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.28e-42
Family Bacterial dinuclear zinc exopeptidases 0.0059
Further Details:      
 
Domain Number 2 Region: 171-277
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000142
Family Bacterial exopeptidase dimerisation domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170291073|ref|YP_001737889.1|
Sequence length 367
Comment peptidase M20 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MSQIDKERLKNILIDLVGIKSFRGKEGELIYYLQDLLARYADKVVHQPVKDCAGNLIAFK
NLKEDNILFLAHTDTFELYSDWTRNPWGELEGDTFYGLGAYDDKGALAAMIEAIMSLPEG
EGKGVVLAAVCDAEGFSRGTYELLKSNLLPKVRGAIVAGPTNMRIFRGAYGRFVFDVDVV
GVSSLGTEEAGVNAIIEAAKIILWAIELPKVDGIGGSVAPLTIKSPELIIAHPDRCLVRL
DRHYPPGQDPGVIKKRFMEYLRKTPELKAKVSISLMKRPTPFMEPYELPENDEFVEYVQE
VCKSTIGRRLETSVYWTVSDANYLNKLGSIKAVIMGPSGGNHHSPDEYVHIPSVYALAEI
LNAILRG
Download sequence
Identical sequences B1L6X7
WP_012310103.1.97847 374847.Kcr_1460 gi|170291073|ref|YP_001737889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]