SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170291154|ref|YP_001737970.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291154|ref|YP_001737970.1|
Domain Number 1 Region: 110-350
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000000000000186
Family Terpene synthases 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170291154|ref|YP_001737970.1|
Sequence length 793
Comment hypothetical protein Kcr_1541 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MLRKSSLLLIILLLSSCASMGQDSRGIIERAVEEPMKSVSSVPDFKSISEVPRGSYGYVN
GVLYVDKSGFTFGAIPDLEFNIYAALILGEALQAYNFASLNPSSVSNARARLSSIASWLS
QQAIDGLWGSDISGKLADVYFSSLAIRAISLAISSGSLPKDKLSSLSSSVSRMISLQDEG
GGWGRIPQADVFQMKQPTPSVTASVLKALLSAREAGLRVPDSSINKALNYLAATASRSGN
MVYWEESGSKALYVTGEVGDAIAEALYQGYSFDESMIRGLINYLDASVRQSYSAGTYDFM
TASALNVLSKLSSLGYLETDKLVSNYGAIMVDLANTIRPDGLFTDFPYIWLRYSYTYPYV
AVFTNWLRITSVSSNAYFVGGYGDYQPTVLVEGTSLNLKVSVSNKISKPLSLIMSVRAGP
PASISGSSEAKFTLEAGKDREFTFKINAPDGLPSPQNVSVSILLREANSSKPIFAKSLPL
RLLRNSVLNLESKVASPISSQLRKPVNITLTFSNRGDLPITDLTFVEKLSSGFELVTTFP
GNGTALVTSTNSLGSYVMPQPLAPGSKMTLVYQVTPVDAPPGPQTVSTTFITYTDARGER
HNLSKDVKITVLRPYLLISSNVSSLKMEWDEEKMILIALSNVGNEDATEVSLKMASGEGL
SLNLSMIPKEVMYRPNPDGSLLLRIDKVASGTTITIPVRVKATNFYPSPELGTFLSVSYE
YKDSIGRTMPGYSGSNIVKVTLSVSKTFLYIVSALIIVLAVLIAIRIKNRVKSTRRSPLL
IERRKRGRIPFES
Download sequence
Identical sequences B1L758
WP_012310184.1.97847 374847.Kcr_1541 gi|170291154|ref|YP_001737970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]