SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170291182|ref|YP_001737998.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291182|ref|YP_001737998.1|
Domain Number 1 Region: 46-116
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000366
Family Ribosomal S5 protein, N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 130-210
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000048
Family Translational machinery components 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170291182|ref|YP_001737998.1|
Sequence length 210
Comment 30S ribosomal protein S5 [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MYEDAGVEREWVPKTWVGRLVAEGKIKSLEEILRRGIPIQEPEIVDILVPGIKEEVVEVI
RVQRQTDAGELTQLRVVAAVGDGMNYVGVGKGKGKEFNIALADAVRNAKLNLIKVRKGCG
SWECGCGRPHSIAAAVTGASGSVRVTLLPAPRKLGIVGNETAKIVLGLGGLQDVRVFSKG
HTRNRMNYAFALHDALRNLLVMNLPQDWRG
Download sequence
Identical sequences B1L786
gi|170291182|ref|YP_001737998.1| 374847.Kcr_1570 WP_012310212.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]