SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170291203|ref|YP_001738019.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291203|ref|YP_001738019.1|
Domain Number 1 Region: 258-370
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.0000000000249
Family Pseudouridine synthase II TruB 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170291203|ref|YP_001738019.1|
Sequence length 373
Comment pseudouridylate synthase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MGKPVDDLLNSLMNLLDSETPSGGGCHLCDGLLSRELGKMLRKALSELEGVELSSVKSGV
SLPAILIEREDRIRANHNPPKMRSLKVTLTRLLDVAISSLTGLKVSQEPDAILIFDFERG
DVKLELAPVFIFGRYRKLQRGISQSRRKCPECGGRGCEACGWKGKIPQGSVEGIVGEVMR
EFFSAEDYVLHGAGREDVDARMLGEGRPFVMELLSPKRRSADLREVESEINRRAAGLIEV
KNLEFSRREKIRILKERSPNVKKLYRALVEVEGGVEEGELELLKGLEGAVIRQRTPKRVL
WRRADITRLKRVYEVNFRRIDDKKFELFVLCDGGLYVKELISGDDGRTSPSVTEILGKKS
FCSELDVLEVMVE
Download sequence
Identical sequences B1L7A7
gi|170291203|ref|YP_001738019.1| 374847.Kcr_1591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]