SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170291222|ref|YP_001738038.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170291222|ref|YP_001738038.1|
Domain Number 1 Region: 6-186
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.75e-26
Family Pseudouridine synthase I TruA 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170291222|ref|YP_001738038.1|
Sequence length 232
Comment tRNA pseudouridine synthase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MAWSVVSLRIAYLGWNYHGVVEQPSLPTVGSALREAMESQGIRAKLRFTSRTDRGVSALD
NIAFYRGPAPNVSLLNSELPKDIAVWAIATGGIPKPKARAYCYAIPFRLSETECVRRALD
ELAQAGLGKNIERIDVKSGENFTYIEIYGKSFKKNEIRRIVGRALELHLGRSIGLAPPEG
LVLTETLTDMKWEEFHRRKLHLIGKMIERELWRLESSRIILGIIKSISSSLL
Download sequence
Identical sequences B1L7C6
374847.Kcr_1610 WP_012310252.1.97847 gi|170291222|ref|YP_001738038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]