SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170289777|ref|YP_001736593.1| from Candidatus Korarchaeum cryptofilum OPF8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170289777|ref|YP_001736593.1|
Domain Number 1 Region: 13-91,176-347
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.88e-85
Family Pyruvate kinase 0.00000954
Further Details:      
 
Domain Number 2 Region: 333-473
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.83e-31
Family Pyruvate kinase, C-terminal domain 0.0017
Further Details:      
 
Domain Number 3 Region: 86-169
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000698
Family Pyruvate kinase beta-barrel domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170289777|ref|YP_001736593.1|
Sequence length 491
Comment pyruvate kinase [Candidatus Korarchaeum cryptofilum OPF8]
Sequence
MASITFSFYCIISPMPMQKTKIIATIGPSSSQIEVLKGMIAEGMSIARLNFSHGTIGEKM
EQIEVIRRASYELGIRLGLMSDLQGPEVRTHMGKKELKIEDGDLVTVSGKEGIGEIKIKP
SSVLRGLEPDDELYIDEGRIRLRVREVDGELLKCEVIQGGLVRDKRSVHASKPFELRGLT
EEDKEAIKASISKGVDFIALSFVKSAEDVTEAMEFMRSISEEPPAIISKIETKEAVERIR
EILDVSYGIMVARGDLGVELPLQEVPKIQKKLIRLANQNAKPVITATEMLESMTQSPIPT
RAEVTDVYNAILDGSDAIMLSAETAIGKYPVLSVRWMRIIAEMAESSLESRLDFPVDNIP
SFIGKAAVEASEILKCPVIFCFTYSGYTARHVARHRPKARIIALSSNKRTSQLLTLTWGV
ETIDVTGDLDEALSYALSYCMDRGILSEEDRIVVTYGHPHGEAKTNTLRILSVRELQRAG
TPKPSEITGPS
Download sequence
Identical sequences B1L381
gi|170289777|ref|YP_001736593.1| 374847.Kcr_0150 WP_012308807.1.97847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]