SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479325517|ref|YP_007865572.1| from Sulfolobus islandicus LAL14/1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|479325517|ref|YP_007865572.1|
Domain Number - Region: 4-20
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0354
Family Classic zinc finger, C2H2 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479325517|ref|YP_007865572.1|
Sequence length 79
Comment Hypothetical Protein SiL_1118 [Sulfolobus islandicus LAL14/1]
Sequence
MSHKYTCNVCGRSFPEGQGIIIEIGGDKLYFHSKSCAYKFLKEMVMEADTDCINSSLKKV
RKKYDEILEQVSKKAEKKI
Download sequence
Identical sequences C3MPP0 C3MYN4 C3N5B6 C3NDX0 C3NHT3 C4KGY2 D2PJT5 F0NHG7 F0NPL1 M9U8X3
gi|229582216|ref|YP_002840615.1| WP_012711266.1.100559 WP_012711266.1.13477 WP_012711266.1.27011 WP_012711266.1.27461 WP_012711266.1.34992 WP_012711266.1.44962 WP_012711266.1.47130 WP_012711266.1.48461 WP_012711266.1.52267 WP_012711266.1.60638 WP_012711266.1.66823 WP_012711266.1.67233 WP_012711266.1.68242 WP_012711266.1.74483 WP_012711266.1.83431 WP_012711266.1.84481 WP_012711266.1.89621 WP_012711266.1.90709 WP_012711266.1.91160 WP_012711266.1.97021 419942.YN1551_1605 426118.M164_1242 427317.M1425_1258 427318.M1627_1308 429572.LS215_1345 439386.YG5714_1243 gi|238619688|ref|YP_002914514.1| gi|227827531|ref|YP_002829311.1| gi|284997641|ref|YP_003419408.1| gi|229584734|ref|YP_002843236.1| gi|385773200|ref|YP_005645766.1| gi|479325517|ref|YP_007865572.1| gi|385775834|ref|YP_005648402.1| gi|227830218|ref|YP_002831998.1| gi|229579033|ref|YP_002837431.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]