SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170077703|ref|YP_001734341.1| from Synechococcus sp. PCC 7002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170077703|ref|YP_001734341.1|
Domain Number 1 Region: 68-153
Classification Level Classification E-value
Superfamily LCCL domain 2.22e-20
Family LCCL domain 0.0012
Further Details:      
 
Domain Number 2 Region: 182-263
Classification Level Classification E-value
Superfamily LCCL domain 1.96e-19
Family LCCL domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170077703|ref|YP_001734341.1|
Sequence length 266
Comment LCCL domain-containing protein [Synechococcus sp. PCC 7002]
Sequence
MQSTTYFFGAIALAFSLGACTQNNTTPESNATGGGTVATPEAAPETPASPPTLQFTALEW
EASPVSLEIQDQVGQTFEFSCPPGDPSQRIWGTGVYTSDSSICAAAVHAGLFAAETGGNL
TLEILAGQDLYTGSQQNAVTSRDYGAWDGSFRFPEASDSAAATTPNIQWDSTPGSFGIAE
NVGDRYSFNCPPNGELGASVWGTDIYTNDSAICVAAVHAGEIDLATGGPITIEIAPGQDS
YTGGDRNGVVTADYGSWGGSFIFLDE
Download sequence
Identical sequences B1XJV7
32049.SYNPCC7002_A1083 gi|170077703|ref|YP_001734341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]