SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170079404|ref|YP_001736042.1| from Synechococcus sp. PCC 7002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170079404|ref|YP_001736042.1|
Domain Number 1 Region: 224-389
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.8e-45
Family Histidine kinase 0.00078
Further Details:      
 
Domain Number 2 Region: 8-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.33e-25
Family KaiB-like 0.0019
Further Details:      
 
Domain Number 3 Region: 148-230
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000128
Family Homodimeric domain of signal transducing histidine kinase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170079404|ref|YP_001736042.1|
Sequence length 395
Comment adaptive-response sensory kinase [Synechococcus sp. PCC 7002]
Sequence
MSAEDQSQLSPVTADIQLRLLLFTDERLAHRSEIKRVQDYLERLRQETDFSLEIINIKDQ
PQLVELYRLVATPSLVKVFPEPLQVFAGSNILPDLERWWGQWLDTVATLRKQLGDRQLAE
VERCDRRLAASQTEHSKEVMRLSDEIFQLQREKEALLKQIEFKDQILAMLAHDLRSPLTG
TSIAIETLEILSKRPETEKTVGLRGQLYQQAKNQLQIMNRMITELLQESRQLLTKLDVKP
QPMALSPLCQQITEQIQERFQRKSIQLVLDIPRDLPEVYGDRELIRQVIVNLLDNAIKYS
PEGGLVRLVGLHRTLQQVQVSVIDTGHGIPEEEQEKIFEGHFRLKRDATQEGYGLGLAVC
RQIIQAHQGRIWVDSTPGQGSEFHFTLPVSGDRQA
Download sequence
Identical sequences B1XN77
32049.SYNPCC7002_A2818 gi|170079404|ref|YP_001736042.1| WP_012308405.1.22074 WP_012308405.1.29953 WP_012308405.1.52632 WP_012308405.1.62705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]