SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158333305|ref|YP_001514477.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333305|ref|YP_001514477.1|
Domain Number 1 Region: 16-147,192-357
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.88e-39
Family Filamentous hemagglutinin FhaB, secretion domain 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|158333305|ref|YP_001514477.1|
Domain Number - Region: 357-460
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000273
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158333305|ref|YP_001514477.1|
Sequence length 727
Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence
MNSKATFLQAAIIWTCLFSPTLAQITSDGTTGSIVNQNNSRFQIEGGVTRGNTLFHSFEK
FSIPTNNQAYFTNPSGINLILSRVTGKGISNINGTLGVEGGADLFLMNPNGIIFGPNASL
DLNGSFLATTGSSFVFEDGKTFSATNPTSVPNFKVSVPLGIQFGNVAAEIKVQARSGISY
SPYKSYFECDCGLSINSGNTISFLSGDFTSERGVINAPNGNIEIGSVDADSFVNLNPFTS
GWSLGYSKVNSFKDISLSGGYIYNSNYSGKAGNRIRFYSRKQIIRDKALIKTFSYNNGIR
GKVLINAAESVSISSGGKIISWSGDFLGSDQSIGGDIEINTGSLSISNLGIIFTDSVNQS
TGGNINIQSKDLKLTNGGRIKTIALDSGSAGNINIQVSDSTNISGKDGYFDTHFNNKIYV
DSGISSTSYGVGKTGNLSLSTKDIEISNGAGIGVLGLGNGPTGFLNIKGENLTLNNNAYI
SMKVTNNKLGNLNIDMSNLLLMNNQSKITYEAEGLGIGGKASISAPMIVAFPNENSDIIL
DAPMADTSINAKEVLGFTKNSKPTKMSDIVVNSEDDRELVGEYGRTSRLKVSEYREAPVQ
PQRIVKGCRPGQALGNGHFAYKGKGGLPPNPYQNRTMPAVWQDLRLHDLESNSVNKYIKL
SHQISKAIRDENKHQTPRESVVEKNIVAEEEIIEAKGWIEDKKGQIILTSSPKKNVVTAN
YQPTATC
Download sequence
Identical sequences B0C551
329726.AM1_0075 gi|158333305|ref|YP_001514477.1| WP_012160784.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]