SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158333336|ref|YP_001514508.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333336|ref|YP_001514508.1|
Domain Number 1 Region: 1076-1405
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000157
Family Galacturonase 0.0096
Further Details:      
 
Domain Number 2 Region: 536-733
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000202
Family Galacturonase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158333336|ref|YP_001514508.1|
Sequence length 1743
Comment hypothetical protein AM1_0106 [Acaryochloris marina MBIC11017]
Sequence
MARRRILDPRLFPNWGQALTLSVLMAGLSPLSTIAKPTTLISPLGQPTPSKTERIEPEPI
SVQITPIGDLDLALKLPPIPTTTRSSLQNDPAHPPLTPQEKPSESHSIPEPSITDLPNPP
LTLAEAGWVPNSQTVPVSSIPVTPPTAQASPIAPPQASSDAPSQTPEDPEPSASLDIPYF
VDAEFRGSTRRQFGVLNLRLPVFQDEKSFAFADVHFEAGSNETFLGNLGLAYRRVLNTAE
ENPWVLGTYAFYDTTRSENGFQYHQGSLGAELISKKFEFRVNGYLPGSNSKVVGQRTVNG
VLSLQPRANGLGADVVQQTLTLETRERALAGFDFEVGHRHHFNDKVSLGLFGGYFFFDSS
ATNSIDGPMARAQLEVQDPLGMNGGLLQVGSRFRFDETRGSELEGFVRLGIPFGGPQRSE
PLSLTQRLARRPIERHYEITTFAQDINLPITLTELQAALTGQGTLSPMGPQITAVTPPQV
ALNPATGQPINIFFVDGDGTAGDGTQDNPLTVAQATSAITQANDILFFLDDAGTINTQTG
LGNSLTLKPGQQALGVGTTPNFVLTVPNLGSVTIFDAGQPQLVNGANNNVLTLANNNTID
GLAFNGQNTAPRGIAAVTGATNTTIRNSSLSNFTVAGIQITPSTNTTIDNVVFNNNATDV
IVNAANTTLTNVVSTNATGPAIQILNATGTTTLTNVDISNAGGDGLQFANPSGTITATNV
DITNAGDNGLEITDGDGTFTFDVASSITNATNAAVNVVGGTTTITYNGTITQNNPASAVN
ITDKTGGTTTFNGLVTANTSTAPGVNLTNNTGSTIAFNGGLDIDTTTGTGFSATNGGTVN
VTATSGDESVTTTSGAALNLSNIVANITFDSVSSTGGTNGINLDTVTGSVGVSGTTTIAN
TTGDGFLATNSTGTYTFGPVTITNAGLDGVDLSGINDATTVFNLGALTINGFTGTGINLA
GANVGVTAPTVAITNTGNVGTGIDLTNTTGNRMITLGDPTNTAGDTPSSIAGVNVGVQLN
NANANFIFGDGELTVDAPSTIAATTPIDASAVGANGTYNFLDVLFLNQTPGTGLGDLFYV
DNIPGGAGTRTDPADIPLGETITNPNDIIILVDNTGMDLLDAIGTNGNDTFQLQDGQSVG
SFLNGTVNLRTRGPSNVLANVTVTDPTGNGAPTSTTTGMSSATLTLANNNQIIGVDISAM
GTNGIEALGVNNATINRNRITNADNGIRLQNLTGAVEIMDNTISQTTDDGIDLGQNNTNL
DSVLISGNTVSNVGEDGIDVDVYNNGLINSVTISNNTVSEVNTSESSGIALNVYTNGQVD
TVTISGNTVSTDSLSTPGIFILSADNSTLNTANITGNTVMMSREDTYGIYVLSTDNSAIN
TANITSNRVSLLDEDLVGILALVNNNSTITTATISDNTLSKTGDGNTGIDVGLINSTLTT
ANISGNTFITTDSDNTGIEVDLINSTLSTANISGNTFNTTVNDVRGIDIDIYNSTLTTAN
ISANTLSLTGGDSSGVNLQLFNGSVINTATISDNSITTTDESISIELDNSTVTTANITGN
NVTTSANNADGIFVSSFYYSTINTANITGNNVTTSGTNADGIFVESYYYSTINTANITGN
NVTTSGTNADGIVVIAEDDYDSRINTANISNNVILQAGRDSVRISNSDINPICTSISGNR
SDSPGFAMAGGTDFNLISEGNTFQVVNLATVSADNNNAVFSFDGTLVPPGTPPAPFTNVA
SCP
Download sequence
Identical sequences B0C6A0
WP_012160813.1.67183 gi|158333336|ref|YP_001514508.1| 329726.AM1_0106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]