SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158333343|ref|YP_001514515.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333343|ref|YP_001514515.1|
Domain Number 1 Region: 111-189
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-16
Family Thioltransferase 0.0083
Further Details:      
 
Weak hits

Sequence:  gi|158333343|ref|YP_001514515.1|
Domain Number - Region: 25-99
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.078
Family Thioltransferase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158333343|ref|YP_001514515.1|
Sequence length 205
Comment glutaredoxin-like protein [Acaryochloris marina MBIC11017]
Sequence
MSGHEVNITLYRWAGAWGPFKVKIPCGECTLTKDVILDTLENELAGIPVILEIREWLTEW
WKPLLKGGWHAPIVMVNGKVISQGHALNRGLLTEAVTAAYASKAPIQRSHLFGKESCPHC
KRAKAYLDQVGIQYTYHDVVRSPRALYEMLARVKPLVGPKTPITVPQIWLGGQYIGGADR
LEQVMQEQGLFRPEFNTVKTTLQPR
Download sequence
Identical sequences B0C6A7
WP_012160820.1.67183 gi|158333343|ref|YP_001514515.1| 329726.AM1_0114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]