SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|158333641|ref|YP_001514813.1| from Acaryochloris marina MBIC11017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158333641|ref|YP_001514813.1|
Domain Number 1 Region: 13-374
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.7e-73
Family TK-like PP module 0.029
Further Details:      
 
Domain Number 2 Region: 399-596
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.12e-19
Family TK-like Pyr module 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158333641|ref|YP_001514813.1|
Sequence length 806
Comment putative phosphoketolase [Acaryochloris marina MBIC11017]
Sequence
MVHTPVAPTSRPLSELELHNIDAYWRACNYLAVGMIYLRDNPLLKEPLQSAHVKHRLLGH
WGASPALSFTYIHCNRLIKKYALDMIFMAGPGHGAPGVLGPVYLEGTYSEIYPDKSEDSE
GMRRFFKQFSFPGFIGSHVTPETPGSIHEGGELGYSVSHAYGAVLDNPDLIVTCVVGDGE
AETGPLATSWHSNKFINPARDGAVLPVLNLNGYKIANPTLLARISHEELEYLFRGYGYTP
YFVEGKNPAEMHQKMAAVMEECILTIKKVQREARINGTLERPRWPMIVLRTPKGWTGPKE
VDGKKVEDFWRSHQVPMGGMQDNPDHLQQLEAWMRSYKPEELFDEHGTLIPELKALTPVG
NRRMGSNPHANGGLLRKALKLPSFQDLAIDIGEQHGTVTFENTKALGIFMREIIRKNPNN
FRLMGPDETASNRLQDVYQVTKKVWMADLYPEDEDGTELSRDGRVMEMLSEHTLQGWLET
YLLTGRHGLFHTYEAFAHVVDSMFNQHAKWLDICRNHVPWRRSVSSLNILLSSLVWRQDH
NGFSHQDPGYVDLVTNKSPDVVRLYFPPDANCLLSVADHCFRSVDYINVIISDKQKHLQY
LSIDEAVAHCTKGIGIWDWASNDDCGTEPDEPDVVMASCGDIPTMEALAATAILREEFPW
LKVRFVNVVDLFKLVSEGEHPHGLSDRDFDSLFTPDKPIIFNFHGYPWLIHKLVYRRSHQ
ERIHVRGYKEQGNINTPLELAIKNEVDRFNLVIDVIDRVPKLGSAAGHAKERMRNKIIEC
LAYAHEHGKDQDEIVNWTWPYVGVCE
Download sequence
Identical sequences B0CB09
WP_012161106.1.67183 gi|158333641|ref|YP_001514813.1| 329726.AM1_0443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]